PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010101716.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family G2-like
Protein Properties Length: 373aa    MW: 41027.3 Da    PI: 8.604
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010101716.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.26.8e-32202257156
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                     k+r++W+peLH+rF++a++qLGGs+ AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  XP_010101716.1 202 KQRRNWSPELHKRFLNALQQLGGSHTATPKQIRELMKVDGLTNDEVKSHLQKYRLH 257
                     79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.926199259IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.0E-28199260IPR009057Homeodomain-like
SuperFamilySSF466894.07E-18200260IPR009057Homeodomain-like
TIGRFAMsTIGR015573.7E-27202257IPR006447Myb domain, plants
PfamPF002492.5E-8204255IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 373 aa     Download sequence    Send to blast
MNYSGLGFRE YVETLEEERK KIQVFQKELP YCLELVTQTI ERCKQQLSGT ATTTECLHGQ  60
SECSEQTSSE GLVFEEFIPL KRTSSDNEDD EDEEQQSPKR KTSINNNNMA DNKKKADWLR  120
SVQLWNNPTP DPAPQKEDVP KKASVLEVKR NGGAFQPFQR EKNVGKRNGS PAPAPAPASA  180
PAASSSSGKR DDETEGQQSQ RKQRRNWSPE LHKRFLNALQ QLGGSHTATP KQIRELMKVD  240
GLTNDEVKSH LQKYRLHTRR PTPATPNNGN AQTPQVVFVG GIWVQPSEYA AAAASAAALG  300
DPSSVTTAAN RIYAPVAAPP PAIQHMAVHR PQQKKQSDSS HSEERISHSG GVQHSNSPAT  360
SSSTHTTTSS PAF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFR7515551e-79FR751555.1 Humulus lupulus mRNA for myb transcription factor (myb5 gene), cultivar Osvald's 72, clone 3366.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010101716.10.0Two-component response regulator
TrEMBLW9RG690.0W9RG69_9R
STRINGVIT_01s0011g03110.t011e-136(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF39183363
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68670.12e-88G2-like family protein